PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g46084.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 554aa    MW: 64623.5 Da    PI: 9.2503
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g46084.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR124.96.7e-085356091
              FAR1 60 tgCkaklkvkkekdgkwevtkleleHnHelap 91
                      tgC+a+++++   d++w++t+l+l HnHel p
  Bradi1g46084.1.p  5 TGCTATMVITYL-DDVWKITRLDLAHNHELHP 35
                      9**********9.9***************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-5435IPR004330FAR1 DNA binding domain
PfamPF105515.5E-34161254IPR018289MULE transposase domain
PROSITE profilePS509669.94444480IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-5444480IPR007527Zinc finger, SWIM-type
SMARTSM005752.8E-6455482IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MVVLTGCTAT MVITYLDDVW KITRLDLAHN HELHPPGESR FLRSHKKMTV EETMMIRTCN  60
ACKIPTRKIM AILAYMRWGG GGGGLKALSY TKKDVSNVRT SIRTESGINE MMKMLEYFLR  120
KKEKDKMFYY KIDSDEEGRV TNIFWSDGYS RELYKDCGDL VSFDTTYRTN RYNLPFAPIV  180
GITSHGDNCL FGCAFLQNEI AKTFIWLFET LLECMGGKEL VSIITDQDAA MRTAIKQVFP  240
RTNHRNCLFH IMKKAQEKAV MTFATTPSLH DDFMDIVHRS VTIAEFERLW TQMTVNYKLE  300
HITYFKIMWA NRWRFVPVYF KTCFYPFVQT TARSEGTNAI FKDNVSCTHS VSSFLDEYDR  360
IAEGIEENQK HHDSVTRDTK AKLNSAYFFE LQAARLLNRS IFYKFQKQVI HSTRYNVDVT  420
EANRKYSVYK TEKQSRKDFR LRRYVVSVNL PASDYSCICC KFQKDGLLCA HVLRVLVHLN  480
ITELDEKYFI DIWRPKEKKI KRNIANNIPV DLTGEDTQMR YNVISKRMTD LASRAVKNNG  540
RYAFLLKEVD NLE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757844.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3FHX50.0A0A0Q3FHX5_BRADI; Uncharacterized protein
STRINGLOC_Os06g36970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-86FAR1-related sequence 5